PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G063000.1
Common NamePHAVU_006G063000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 193aa    MW: 22217.6 Da    PI: 9.4966
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G063000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.7e-125295347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         WT eE+ l++++  ++G g Wk+I+ +++ ++ + q+ s+ qky
  Phvul.006G063000.1 52 TWTMEEHRLFLEGLSMYGRGYWKKISYYIQ-TKDATQVASHAQKY 95
                        6*****************************.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-94298IPR009057Homeodomain-like
PROSITE profilePS5129414.2145100IPR017930Myb domain
SuperFamilySSF466892.08E-144799IPR009057Homeodomain-like
SMARTSM007175.0E-74998IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.2E-134998IPR006447Myb domain, plants
CDDcd001674.26E-85296No hitNo description
PfamPF002491.1E-105295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MINGPPIMLP EATSLSGHPH QDVVEAPLML PPSQTSKQCG IQVQSNKRKK ITWTMEEHRL  60
FLEGLSMYGR GYWKKISYYI QTKDATQVAS HAQKYFMRNK ISQEKKKRKS IHDMVLSQPM  120
QVQEGIHFNP PINMPHPVHL NLVNVTHQIP PITGMMQSNH INHINHHPQY NGIDQMMEDN  180
YINNVVYPTL FD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146710.11e-142hypothetical protein PHAVU_006G063000g
TrEMBLV7BL571e-142V7BL57_PHAVU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.11e-21MYB_related family protein